PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.TXW03
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 285aa    MW: 33042.6 Da    PI: 9.9225
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.TXW03genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.51.1e-135801798
                 E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                  +p+kf +++gg+ +++  ++l+ ++g +W++    ++++g++++++GWkeF+    L+ g ++ F+++g+s+   +v +f+
  Araip.TXW03  5 KIPNKFSRKYGGDMPNP--VQLQPPDGTEWRIDW--TNHDGEILFENGWKEFATFYTLENGHVLWFEYNGTSNI--KVNIFD 80
                 69********9998776..***************..*******************************9986555..888886 PP

2B339.21.2e-122222833799
                  EEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  37 tledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +++ e+ ++W  +liy  +++  +++ +W+ F ++n+Lk+gD+++F+l++r++  l+v+++r+
  Araip.TXW03 222 RMYFENRKQWHATLIYYPNRKNALIS-NWRLFLEENNLKAGDVCIFELINRQGPDLKVHIRRS 283
                  4555678*********9998777666.**********************999999*****996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.915182IPR003340B3 DNA binding domain
SMARTSM010190.0026282IPR003340B3 DNA binding domain
PfamPF023622.8E-11580IPR003340B3 DNA binding domain
SuperFamilySSF1019361.37E-16589IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-16582IPR015300DNA-binding pseudobarrel domain
CDDcd100172.76E-9680No hitNo description
Gene3DG3DSA:2.40.330.103.7E-12192283IPR015300DNA-binding pseudobarrel domain
CDDcd100172.73E-12193282No hitNo description
SuperFamilySSF1019361.12E-13193283IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.002200284IPR003340B3 DNA binding domain
PfamPF023623.5E-10226283IPR003340B3 DNA binding domain
PROSITE profilePS5086310.236229284IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MALQKIPNKF SRKYGGDMPN PVQLQPPDGT EWRIDWTNHD GEILFENGWK EFATFYTLEN  60
GHVLWFEYNG TSNIKVNIFD MSALEIDYPS NGRIGDDNSV EILDEPPARR GRGRPKKNVI  120
AEPKQSRAST STSKIMKSAI KTKDIDKNPN TKKLKQHVEN EKDGQSEESA DLKLPIIQRA  180
RPDMDVIREA KKFKSKNPSF VIKIKQMHQT GSPANLPVCF FRMYFENRKQ WHATLIYYPN  240
RKNALISNWR LFLEENNLKA GDVCIFELIN RQGPDLKVHI RRSHD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016178706.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.19e-26B3 family protein